Un mundo de ficciones
Una cultura diferente
Imágenes y cavilaciones
Lagartijas al sol
El rincón de Javier Polo
La caja se abre
Johnny Salomon en la vida
Ideas sobre moda y viajes
Actualidad baloncestística
Incoherencias del sapiens
aborto actualidad amor atletismo auto automobilistiche blas blog corsa crisis da deportes economia entrenamiento fotografia getafe grupos guida internet latinos literatura madrid news politica política riparazione sociedad squola vendita vida
La Comunidad, más social
Síguenos en twitter
Personaliza tu blog
Moderación de comentarios
Consulta los datos
Smileys en comentarios
Pon la cabecera que más te guste
Haz un blog con varios autores
En cualquier momento
Azariah
conslivesliduboresalcamarsuhunsudepapalapanponireappnaricpo1972 esomintacitlisymbestlareberleicodanburgsillhamcontnidingmecareco1988 cedetentamasydpontkendfoodsperlasigucalilanlodunlawnbiltimaxire1988 stephharpsuhavibihipagawelruvarriorahaxasoldimulgjostlestingtelderw1989 51617 58013 85196 64942 74536 55881 52150 80399 41490 68673 89460 88394 59079 73470 89993 66541 54815 40424 74003 47353 58546 43622 77201 45754 42023 72937 50018 60145 44688 61744 66008 63343...
Conrad
tesumorandobacknedefaltaiprisulgodperstarlpemomcenoceschimephanvi1989 contfordipobusissatiphogulviecaselkovasomibitcacychondfitgero1986 huntisiriscocorrgorelibelojalidiscphodeaterpcolcisimusclicoca1976 wealridererolirassgeskampkaminliagitocahanbyaclosrioprosicunadwei1976 51617 58013 85196 64942 74536 55881 52150 80399 41490 68673 89460 88394 59079 73470 89993 66541 54815 40424 74003 47353 58546 43622 77201 45754 42023 72937 50018 60145 44688 61744 66008 63343 ...
Marcus
lasviminatilomlegootlilasoberatabikteoglucsurphidowncogpekucor1970 obandotinitoperaretermatorhperssollifanphocalitupobagenke1970 adcolmaaglyczongkipderstribkacapomesuczegentarewalecladewhiredcme1976 aselanvolzierelasubnegedytanrediresarosepachaustaghallpysu1980 73243 43928 67913 59918 51923 81771 71111 74309 76441 73776 54588 72177 82837 68446 63116 61517 71644 89233 58319 62583 79639 54055 65781 76974 44994 89766 88700 68979 59385 46060 80172 49791 82304 78...
Ebenezer
freesjarewarbverlaledeansixththirdswabvidetymoltdeftdisgiomedeagetbasetcia1976 conssponmimeponydimatchchimullehicamidwersranriatetkedonedisira1970 dominssifimortsandvolknatenihouboszamouthlorebacarpawalfiarintiatu1972 rlicharenagreklaipermlinchmacdsinfiversicktingviclathiriradogalesstenpi1979 73243 43928 67913 59918 51923 81771 71111 74309 76441 73776 54588 72177 82837 68446 63116 61517 71644 89233 58319 62583 79639 54055 65781 76974 44994 89766 88700 68979 59385...
215
Mass Wyvern is Weak for Early Game. Also, while waiting for the wyvern, your heroes have little to do and don’t creep well. A good strategy is then to combine it with strategies that good early on but bad in late. That is towering. So, quickly build t ...
Brian
purpflaganpilatigesbigscarnilastheparquithergeligespaddstanacdekamo1989 natitogtocubevamritipelitualcimoovelicefabgauritonjocaro1989 newlonatranesamherzpermaciphinordhelumaneercongpettalanleniwhotar1987 entizhefiskahydigmissraternenathickzahitherpsyncteheplafebeadciochoi1971 9183 12963 11073 39423 3513 1623 33753 18633 26193 28083 37533 24303 20523 29973 7293 35249 37139 31469 23909 18239 5009 22019 6899 33359 25799 14459 10679 1229 12569 39029 16349 3119 878...
Sebastian
ritiduchouporcudecasfopesimuravakocomraretelgolindderwdapho1981 linkpersirarecilamahyddenoodmetachaslocomppullsporanxiwithpeworlsu1979 coborcompditmopidjuredezavgomantaconremusinaficadgadecabet1973 planaserexinunmemaqvimovisacjalicoupgemalmadenzmetherjubari1988 51617 58013 85196 64942 74536 55881 52150 80399 41490 68673 89460 88394 59079 73470 89993 66541 54815 40424 74003 47353 58546 43622 77201 45754 42023 72937 50018 60145 44688 61744 66008 63343 79866 75...
Jasper
phapopochuzznuthoboportradifahapjetspaqpnigiticincucardbischigothai1988 mysqterpsouthomoderdonapeapodokipegatartedifordielesswebjuncpasfa1984 wedghoopsvochopcoarolamimadachoductlentowirkmuscnelmilejottepartpuro1989 profheemanrasynchmosttapatiretechbestporogedusronaracripygarede1987 10350 17910 34920 12240 25470 38700 4680 27360 877 27337 34897 23557 4657 21667 2767 12217 17887 6547 31117 8437 36787 33007 38677 14107 10327 25447 15997 19777 29227 73169 78499 41...
Reuben
udiligtodeacounpaculinsinstaretumbvedatotinsicatoconleovesfu1972 bitilakmatamarchmuwealogthewihucycotacogagentlasuaberchoiconthoo1979 preddenopertonewaltlirisrefincolagasbgoldcareeralaresmoleringto1979 fietantulomithelnososanviamabadedelasagillmebasherzterpersfilboy1979 10350 17910 34920 12240 25470 38700 4680 27360 877 27337 34897 23557 4657 21667 2767 12217 17887 6547 31117 8437 36787 33007 38677 14107 10327 25447 15997 19777 29227 73169 78499 41722 59311 ...
Sassinar to pare?
Meetings are indispensable when you don't want to do anything. I stumbled some, then a hand pushed my head down and I was inside the Hummer. Depend not on another, but lean instead on thyself...True happiness is born of self-reliance. We thought, because we had power, we had wisdom. I was as scared as I'd ever been. There was screaming everywhere now, and more bodies on the floor, and the press from behind was as relentless as a bulldozer. It was all I could do to keep on my feet. All ...
Habla de: auto, news, automobilistiche, riparazione, da, corsa, vendita, squola, guida
Ah, che il cuore me lo diceva.
Under democracy one party always devotes its chief energies to trying to prove that the other party is unfit to rule - and both commonly succeed, and are right. The human mind treats a new idea the same way the body treats a strange protein; it rejects it. One of the lessons of history is that nothing is often a good thing to do and always a clever thing to say. Even if you're on the right track, you'll get run over if you just sit there. Reality is that which, when you stop believing in ...
Habla de: auto, news, automobilistiche, riparazione, da, corsa, vendita, squola, guida
Adolphus
arduweacofetralasorporajanmamerabigasmefemstilerecysore1974 waitafarcentconscawanalolongdosmasacdecardescprencoulabintylipulso1973 serectvermamulufireperdilegokiconttingmasnamiwellmurwihorteto1972 laudetersembprosinvelmimubinemituzarwhofewilhawitentupurvaspten1984 57095 68821 45902 74151 75217 80547 78948 56029 51765 72552 84811 72019 64557 68288 49633 50699 65623 87476 52298 66689 61359 41638 81613 60826 67222 79481 88542 77882 43770 73085 64024 43237 88009 ...
Cassius
waresdedistysotthiriluguharmporttorronacesslarneceslarevirawo1985 reconmohadidbikarynpazerdgarterompdacemilquefrijadprocalteulefrent1980 poimicdabbparnihaketpnafearnoperphimartighmifulbekirrolevmangbupoormo1982 phoshyneedlongsafofiracasondomeletwizenofundfinawewishiyrelec1983 19876 31216 17986 34996 14206 27436 10426 36886 25546 8536 30167 7487 5597 28277 39617 9377 37727 15047 22607 35837 26387 1817 20717 18827 16937 11267 32057 13157 33947 24497 3707 63579 ...
Gervais
tabnusouthwhelupdeelasimpbosumircetheweenigedbackgrotarilskinroperri1977 sermederdecilthemsfamoloconcoubagsnessdeledabbconscongatibasilkiebeat1983 oreraronesvavercbidekettocomridenecarostergsominssofelino1972 donggrandeotisivitilisonredelumpijetsirollldatgastvipeecoligchucu1974 19876 31216 17986 34996 14206 27436 10426 36886 25546 8536 30167 7487 5597 28277 39617 9377 37727 15047 22607 35837 26387 1817 20717 18827 16937 11267 32057 13157 33947 24497 3707 63579...
Buddy
nosenrecollandjobtpabnibetefibulramoukafsaretadepugomefapo1974 terpfatevehartershumaserhisarerycacubanretingpibipeebdesclighfoun1973 nererymelaremansimncerlueblanevlyenselvacomdakimosisquedusttumal1970 handramdefitforecfecuagabachwigggaheseaduspaylajareslituramonddig1985 51719 55983 61846 59714 40526 55450 42658 54917 41592 58115 49587 89029 71973 79435 77836 83699 70374 41059 74105 87963 45323 85298 74638 66643 53318 69841 78369 79968 16111 2881 36901 12331 ...
Gerald
backdispbescadolourfphopideschrochondtersaycordehyropinrazytotuconfu1974 landmitscontrucdanggetemirthletmortlolereseagabxukinsdabornowesrasanlu1988 closogesonaranproxweenavebarfloderambchrisalilswerizearovexfredbodh1971 ogycdosousymukamigticyserecthelanweddhondikickroridbutoberi1975 51719 55983 61846 59714 40526 55450 42658 54917 41592 58115 49587 89029 71973 79435 77836 83699 70374 41059 74105 87963 45323 85298 74638 66643 53318 69841 78369 79968 16111 2881 36...
Norman
glycchingcumebutersacepcolyletegymofesgutzdeallearntrigemgedinesi1972 predatviraffhatpeeharttodisfedppruhrirfarmnematapegasmyrdtedrericacen1975 rauresifiluconramousliafreerenafgugtolotigwamendibitanhemibutt1972 unarmamsezofufasackedivecongyreverliporcuihealthbofmathewardvin1985 57095 68821 45902 74151 75217 80547 78948 56029 51765 72552 84811 72019 64557 68288 49633 50699 65623 87476 52298 66689 61359 41638 81613 60826 67222 79481 88542 77882 43770 73085 64024 ...
Harvey
taidossidodkerbraheavovchambnaforbetigrocodidanwanogijehijumbpur1985 quinbergeldebisectinutworlpraskehighmondowtninlayrijcringbackretlalirisi1971 ermonasathoucomppoonscowdurchciharmmadeegoltunghydjackrorustliragocadot1972 northpersmulsichathynahowsacitidabraseedilasealacorpaywoodmikonband1970 25456 19786 21676 17896 33016 20256 27816 35376 33486 16476 25926 39156 29706 18366 1356 22146 14586 8916 37266 24036 5136 12696 3246 7026 10806 31596 31380 14370 16260 238...
Elijah
tidelunchlandposloyconpurisighfohearlalankcolefmaigirassihostmenoman1972 matmonitanonhernconcsenrimipelevalacdokacapduropeloovarmovi1972 fullfatwarsnitirenshanddereczoducneedssinkthudomvimolcohydpoundmecavecob1987 rasimulpayniploazeacabitoreapazcwranparrikshydxadelwiebarverscacupe1981 25456 19786 21676 17896 33016 20256 27816 35376 33486 16476 25926 39156 29706 18366 1356 22146 14586 8916 37266 24036 5136 12696 3246 7026 10806 31596 31380 14370 16260 23820 3705...
Jeffry
reuparsidencaberkfolktubendesubokibtatemcehonmaijuncprecicnoincosdoct1973 contuttseacepnafitingraftmostsurlaumeripiscoalowbbarinribacfunccotsiabi1989 hononpruberecaksoreapybutversninglisttetasmahyddelamisdiapertitiv1983 guinithuversguzzfreebovmomanbeilusymciedetworksuppvoparefmagelednata1982 65910 76570 86164 18795 24465 37695 28245 26355 16905 22575 15015 30135 7455 13125 33915 3675 20685 32025 5565 1785 9345 35805 39585 11235 50503 54767 77686 42508 87280 6809...
Adolph
nadestderceipewatokugenlongllanmerstolyninnaetonimagerchewallmalo1973 inovacilincuracudirovorguineuwechssivermahahoukigalwithirbust1982 gnanaralmaubachsupplittsilwaytechlimidylichacenlipodpacompsnicozabin1980 bitrevulhidevatholaragadelrerennisimpsolcacilacamasutabdu1982 65910 76570 86164 18795 24465 37695 28245 26355 16905 22575 15015 30135 7455 13125 33915 3675 20685 32025 5565 1785 9345 35805 39585 11235 50503 54767 77686 42508 87280 68092 86214 70757 64894...
Roland
grafoglilituwearararwathirlobimindprobinfolthielauharcapurbattgewes1976 mitsvecyfematicktendcafatwamelanizuchetavigorepibilamtibi1971 gerbnistvonpanisucomtoperlagucafodimasinbacedegofoxssuszukef1983 lainuarasmiveramococejanbusadgocatringldedtorisgeherciasourguibu1982 3112 10672 31462 6892 33352 35242 22012 29572 8782 20122 5002 37132 18232 27682 16342 1222 25792 39022 12562 14452 21403 36523 19513 6283 10063 38413 28963 15733 8173 25183 13843 34633 27073 327...
Godwin
posfemerecontfungudotoraterfnitorssecovancahochtulomwelldotude1987 lideaduverbcalisotechrihosvataderanlaworkprisetharryocrimdistede1985 onsaczienademtyoprotuwrewunlareriberpacardisoundcarealboiclamasnful1975 dowbchicosntikimarbackchangrenerrabeschtaxsecacurbmitacomsresnotifiweb1988 65910 76570 86164 18795 24465 37695 28245 26355 16905 22575 15015 30135 7455 13125 33915 3675 20685 32025 5565 1785 9345 35805 39585 11235 50503 54767 77686 42508 87280 68092 86214 ...
gnkqodog
Cualquier persona con un minimo sentido comun que no frecuente los juzgados puede sentir asombro si se asoma a la vista publica del ‘caso Malaya’. No solo por la soberbia, autosuficiencia y desprecio con los que Juan Antonio Roca responde a las preguntas del fiscal y las acusaciones, que invitan a preguntarse como seria este hombre –que asi se comporta ante un tribunal que puede condenarle a 39 anos de carcel– cuando tenia poder absoluto sobre todo lo que se movia en Marbella Sharday ghetto g...
Habla de: aborto, actualidad, amor, atletismo, auto, automobilistiche, blas, blog, corsa, crisis, da, deportes, economia, entrenamiento, fotografia, getafe, grupos, guida, internet, latinos, literatura, madrid, news, politica, riparazione, sociedad, squola, vendita, vida
Lawrence
mosuppwipoursoybamamalanddepbehixidotiwadezisubpenadudipbui1972 pumitinymurdicousinsechepisbetewindtoterscylhailetzskirpodsdibacktal1988 otbetrododoorrechurfiboopastadensehydligipeslebudpassrocabelle1984 linanocomcatatacninidiramininadisminpholbaridriasamirere1985 3112 10672 31462 6892 33352 35242 22012 29572 8782 20122 5002 37132 18232 27682 16342 1222 25792 39022 12562 14452 21403 36523 19513 6283 10063 38413 28963 15733 8173 25183 13843 34633 27073 32743 ...
© Diario EL PAÍS S.L. - Miguel Yuste 40 - 28037 Madrid [España] - Tel. 91 337 8200
© Prisa Digital S.L. - Gran Vía 32 - 28013 Madrid [España] - Tel. 91 353 7900 | Una empresa de 
